PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0499s0060.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 679aa    MW: 76838.4 Da    PI: 8.9768
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0499s0060.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.16.8e-23140241199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k lt sd++++g +++ k++a+e+      +++++  ++l+ +d++g++W++++i+r++++r++l++GW+ Fv+a++L +gD ++
  SapurV1A.0499s0060.7.p 140 FCKMLTASDTSTHGGFSVLKRHADEClppldmSLQPPV-QELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSAKKLVAGDAFI 225
                             89*****************************9666655.49********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   + +++el+v+v+r+
  SapurV1A.0499s0060.7.p 226 FL--RGETEELRVGVRRA 241
                             **..3489999****985 PP

2Auxin_resp117.21.4e-38266348183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+s+F+v+Y+Pr+s++eF+++++k+++++k++++vGmRfkm+fe e+++e+r+ Gtv+gv+++dp +Wp+S+Wr+Lk
  SapurV1A.0499s0060.7.p 266 AWHAVSTGSMFTVYYKPRTSPAEFIIPIDKYKESVKINYAVGMRFKMRFEAEEAPEQRFCGTVIGVEEADPKKWPRSNWRCLK 348
                             89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.9E-39134255IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-39134269IPR015300DNA-binding pseudobarrel domain
CDDcd100171.54E-19138240No hitNo description
PROSITE profilePS5086311.42140242IPR003340B3 DNA binding domain
SMARTSM010191.4E-21140242IPR003340B3 DNA binding domain
PfamPF023627.7E-21140241IPR003340B3 DNA binding domain
PfamPF065074.0E-35266348IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MINRSNSVDI NRNGIARRSW SFPVSCEGSE DALYKELWHA CAGPLVTVPR QGELVYYFPQ  60
GHIEQVEAST NQVADDQQMP AYNLSSKILC RVVNVQLKAE LDTDEVFAQV ILLPETQQDV  120
ELVEEEDLPP PPTRPRVHSF CKMLTASDTS THGGFSVLKR HADECLPPLD MSLQPPVQEL  180
VAKDLHGNEW RFRHIFRGQP RRHLLQSGWS LFVSAKKLVA GDAFIFLRGE TEELRVGVRR  240
ALRQPSKIPS SVISSHSMHI GILATAWHAV STGSMFTVYY KPRTSPAEFI IPIDKYKESV  300
KINYAVGMRF KMRFEAEEAP EQRFCGTVIG VEEADPKKWP RSNWRCLKVH WDETSTVHRP  360
DRVSPWKVEP ALAPSMDPVS GCRLKRHRSK TVTSSADSST LTMKDNGPSR HVQHQEIMTL  420
RNTPTGKYYL DNNHNPPWVI SQGTGTLLKS YESSRPFFDQ PSKLPSDEKS MFNWHSAPMM  480
HAGHPLNMLA SSMEGQVAKD KDRLQQHGSW FSSLPYANSS PHPLSSKPQH LPFQQCNVRT  540
SKDDNCKLFG FSLFGNYKAP EPATIHRHSA DKPQQQINVA SDHLQLLGSD RFLEQLKHPK  600
HARCEEQGNI FQASAFQSKD VQGNPKGGSV RRCVKVVTYF NAVIKTPFIN NIFLFTLDMK  660
LQFVCGLYWL RFTSTGLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1683137017354Auxin response factor 1
4ldw_A1e-1683137017354Auxin response factor 1
4ldv_A1e-1683137017354Auxin response factor 1
4ldx_B1e-1683137017354Auxin response factor 1
4ldx_A1e-1683137017354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2084820.0AC208482.1 Populus trichocarpa clone JGIACSB13-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303753.20.0hypothetical protein POPTR_0003s16210g
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9GZ320.0B9GZ32_POPTR; Auxin response factor
STRINGPOPTR_0003s16210.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2